PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do011505.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family TALE
Protein Properties Length: 339aa    MW: 37418.9 Da    PI: 6.6769
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do011505.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.61.2e-092542892055
                 HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 +k +yps++e+  LA+ +gL+++q+ +WF N+R ++
  Do011505.1 254 YKWPYPSETEKIALAETTGLDQKQINNWFINQRKRH 289
                 4679*****************************885 PP

2ELK439.6e-15209230122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELKhqLlrKY+gyLg+L+qEFs
  Do011505.1 209 ELKHQLLRKYGGYLGGLRQEFS 230
                 9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012556.5E-2077121IPR005540KNOX1
PfamPF037901.7E-2178119IPR005540KNOX1
SMARTSM012562.3E-28129180IPR005541KNOX2
PfamPF037913.5E-23134179IPR005541KNOX2
PfamPF037893.6E-11209230IPR005539ELK domain
SMARTSM011884.2E-8209230IPR005539ELK domain
PROSITE profilePS5121311.575209229IPR005539ELK domain
PROSITE profilePS5007112.989229292IPR001356Homeobox domain
SuperFamilySSF466891.37E-19230300IPR009057Homeodomain-like
SMARTSM003892.8E-12231296IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.8E-28234295IPR009057Homeodomain-like
CDDcd000865.50E-13241292No hitNo description
PfamPF059208.3E-17249288IPR008422Homeobox KN domain
PROSITE patternPS000270267290IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MDSFGDHGGG GSSASKASFL QLPLPASSGQ GFPSPDGHHH SSRLALQQLL AGPSAAQHSH  60
HKDGAVVQGE ISPVDAETIK AKIMSHPQYK ALVSAYLDCQ KVGAPPDVSD RLSAMAGKLD  120
AQPGSSQRRH EPTRADPELD QFMEAYCNML VKYQEELTRP IQEAAGFFKS VERQLDSITE  180
SSCEGAGSSE DDQDTSCAED IDPCAEDKEL KHQLLRKYGG YLGGLRQEFS KRKKKGKLPK  240
EARQKLLHWW ELHYKWPYPS ETEKIALAET TGLDQKQINN WFINQRKRHW KPTSEDMPFA  300
AMMEAGGFHG PPHPQGAAAL YMDSSRPPFM ADGMYRLGS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00671PBMTransfer from GRMZM2G135447Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981606.10.0PREDICTED: homeobox protein knotted-1-like 12
SwissprotO804161e-121KNOSC_ORYSJ; Homeobox protein knotted-1-like 12
SwissprotO650341e-121KNOSC_ORYSI; Homeobox protein knotted-1-like 12
TrEMBLA0A0A9GAR10.0A0A0A9GAR1_ARUDO; Uncharacterized protein
STRINGSb01g006790.11e-172(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40613873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.12e-90KNOTTED-like from Arabidopsis thaliana